HPA001600

ELK3 antibody from Sigma-Aldrich
ERP, NET, SAP2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA001600
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA001600, RRID:AB_1078752
Product name
Anti-ELK3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA001600
Antibody type
Polyclonal
Antigen
ETS domain-containing protein Elk-3 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
KNIIKKVIGQKFVYKFVSFPEILKMDPHAVEISRE
SLLLQDSDCKASPEGREAHKHGLAALRSTSRNEYI
HSGLYSSFTINSLQNPPDAFKAIKTEKLEEPPEDS
PPVEEVRTVIRFVTNKTDKHVTR
Storage
-20C
Provider Type Product Number
- No reagents -