HPA002084

SIM1 antibody from Sigma-Aldrich
bHLHe14
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA002084
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA002084, RRID:AB_1079972
Product name
Anti-SIM1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA002084
Antibody type
Polyclonal
Antigen
Single-minded homolog 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
ANTSPCDHIQQREGKMLSPHENDYDNSPTALSRIS
SPNSDRISKSSLILAKDYLHSDISPHQTAGDHPTV
SPNCFGSHRQYFDKHAYTLTGYALEHLYDSETIRN
YSLGCNGSHFDVTSHLRMQPDPAQGHKGTSV
Storage
-20C
Provider Type Product Number
- No reagents -