WH0007528M1

YY1 antibody from Sigma-Aldrich
DELTA, INO80S, NF-E1, UCRBP, YIN-YANG-1
ELISA
Recommended by provider
Immunocytochemistry
Recommended by provider
Immunohistochemistry
Recommended by provider

Antibody data

Product number
WH0007528M1
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#WH0007528M1, RRID:AB_1844256
Product name
Monoclonal Anti-YY1 antibody produced in mouse
Provider product page
Sigma-Aldrich - WH0007528M1
Antibody type
Monoclonal
Antigen
YY1 (NP_003394, a.a. 221-321) partial recombinant protein with GST tag. MW of the GST tag alone is 26 kDa.
Description
purified immunoglobulin
Reactivity
Human
Antigen sequence
VTMWSSDEKKDIDHETVVEEQIIGENSPPDYSEYM
TGKKLPPGGIPGIDLSDPKQLAEFARMKPRKIKED
DAPRTIACPHKGCTKMFRDNSAMRKHLHTH* (wi
thout GST)
Isotype
IgG
Storage
-20C
Provider Type Product Number
- No reagents -