H00007528-M02
antibody from Abnova Corporation
Targeting: YY1
DELTA, INO80S, NF-E1, UCRBP, YIN-YANG-1
Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00007528-M02 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00007528-M02, RRID:AB_530229
- Product name
- YY1 monoclonal antibody (M02), clone 4A5
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant YY1.
- Antigen sequence
VTMWSSDEKKDIDHETVVEEQIIGENSPPDYSEYM
TGKKLPPGGIPGIDLSDPKQLAEFARMKPRKIKED
DAPRTIACPHKGCTKMFRDNSAMRKHLHTH- Isotype
- IgG
- Antibody clone number
- 4A5
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Gene expression profiling of human hepatoblastoma using archived formalin-fixed and paraffin-embedded tissues.
Shin E, Lee KB, Park SY, Kim SH, Ryu HS, Park YN, Yu E, Jang JJ
Virchows Archiv : an international journal of pathology 2011 Apr;458(4):453-65
Virchows Archiv : an international journal of pathology 2011 Apr;458(4):453-65
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- YY1 monoclonal antibody (M02), clone 4A5 Western Blot analysis of YY1 expression in Hela S3 NE ( Cat # L013V3 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged YY1 is approximately 0.03ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunofluorescence of monoclonal antibody to YY1 on HeLa cell. [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunoperoxidase of monoclonal antibody to YY1 on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 3 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol