Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN184332 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-YY1 Transcription Factor (YY1) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-YY1 antibody: synthetic peptide directed towards the middle region of human YY1
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Xenopus, Zebrafish
- Host
- Rabbit
- Antigen sequence
KQLAEFARMKPRKIKEDDAPRTIACPHKGCTKMFR
DNSAM RKHLHTHGPR- Vial size
- 50 μg
- Storage
- Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen. For longer periods of storage, store at -20°C
Submitted references YY1 inhibits the activation of the p53 tumor suppressor in response to genotoxic stress.
Grönroos E, Terentiev AA, Punga T, Ericsson J
Proceedings of the National Academy of Sciences of the United States of America 2004 Aug 17;101(33):12165-70
Proceedings of the National Academy of Sciences of the United States of America 2004 Aug 17;101(33):12165-70
No comments: Submit comment
No validations: Submit validation data