Antibody data

Product number
H00006722-M05
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00006722-M05, RRID:AB_1137048
Product name
SRF monoclonal antibody (M05), clone 4D2
Provider product page
Abnova Corporation - H00006722-M05
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full-length recombinant SRF.
Antigen sequence
TDLTYQVSESDSSGETKDTLKPAFTVTNLPGTTST
IQTAPSTSTTMQVSSGPSFPITNYLAPVSASVSPS
AVSSANGTVLKSTGSGPV
Isotype
IgG
Antibody clone number
4D2
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -