Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Chromatin Immunoprecipitation [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN184323 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-SRF antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-SRF antibody: synthetic peptide directed towards the N terminal of human SRF
- Description
- Protein A purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Xenopus, Zebrafish
- Host
- Rabbit
- Antigen sequence
ATGGYGPVSGAVSGAKPGKKTRGRVKIKMEFIDNK
LRRYT TFSKRKTGIM- Vial size
- 0.1 mg
- Storage
- Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen. For longer periods of storage, store at -20°C
Submitted references HERP1 inhibits myocardin-induced vascular smooth muscle cell differentiation by interfering with SRF binding to CArG box.
Doi H, Iso T, Yamazaki M, Akiyama H, Kanai H, Sato H, Kawai-Kowase K, Tanaka T, Maeno T, Okamoto E, Arai M, Kedes L, Kurabayashi M
Arteriosclerosis, thrombosis, and vascular biology 2005 Nov;25(11):2328-34
Arteriosclerosis, thrombosis, and vascular biology 2005 Nov;25(11):2328-34
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- ChIP