HPA017678

TMEM131 antibody from Sigma-Aldrich
CC28, KIAA0257, PRO1048, RW1, YR-23
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA017678
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA017678, RRID:AB_1858086
Product name
Anti-TMEM131 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA017678
Antibody type
Polyclonal
Antigen
Transmembrane protein 131 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PKIEERFIDFGVLSATEASNILFAIINSNPIELAI
KSWHIIGDGLSIELVAVERGNRTTIISSLPEFEKS
SLSDQSSVTLASGYFAVFRVKLTAKKLEGIHDGAI
QITTDYE
Storage
-20C
Provider Type Product Number
- No reagents -