ABIN501296
antibody from antibodies-online
Targeting: ZNF148
BERF-1, BFCOL1, HT-BETA, pHZ-52, ZBP-89, ZFP148
Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN501296 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Zinc Finger Protein 148 (ZNF148) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-ZNF148 antibody: synthetic peptide directed towards the middle region of human ZNF148
- Reactivity
- Human, Mouse, Rat, Bovine, Canine
- Host
- Rabbit
- Antigen sequence
QHSFPFSGDETNHASATSTQDFLDQVTSQKKAEAQ
PVHQA YQMSSFEQPF- Vial size
- 50 µg
Submitted references MicroRNA-203 enhances coxsackievirus B3 replication through targeting zinc finger protein-148.
Sumoylation-dependent control of homotypic and heterotypic synergy by the Kruppel-type zinc finger protein ZBP-89.
Hemida MG, Ye X, Zhang HM, Hanson PJ, Liu Z, McManus BM, Yang D
Cellular and molecular life sciences : CMLS 2013 Jan;70(2):277-91
Cellular and molecular life sciences : CMLS 2013 Jan;70(2):277-91
Sumoylation-dependent control of homotypic and heterotypic synergy by the Kruppel-type zinc finger protein ZBP-89.
Chupreta S, Brevig H, Bai L, Merchant JL, Iñiguez-Lluhí JA
The Journal of biological chemistry 2007 Dec 14;282(50):36155-66
The Journal of biological chemistry 2007 Dec 14;282(50):36155-66
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Image(s): Western Blotting