Antibody data
- Antibody Data
- Antigen structure
- References [4]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN182608 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Forkhead Box P1 (FOXP1) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-FOXP1 antibody: synthetic peptide directed towards the N terminal of human FOXP1
- Description
- Protein A purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian
- Host
- Rabbit
- Antigen sequence
MIPTELQQLWKEVTSAHTAEETTGNNHSSLDLTTT
CVSSS APSKTSLI- Epitope
- N-Term
- Vial size
- 100 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Forkhead box protein p1 is a transcriptional repressor of immune signaling in the CNS: implications for transcriptional dysregulation in Huntington disease.
FoxP1 promotes midbrain identity in embryonic stem cell-derived dopamine neurons by regulating Pitx3.
Cooperative regulation in development by SMRT and FOXP1.
Integrin engagement regulates monocyte differentiation through the forkhead transcription factor Foxp1.
Tang B, Becanovic K, Desplats PA, Spencer B, Hill AM, Connolly C, Masliah E, Leavitt BR, Thomas EA
Human molecular genetics 2012 Jul 15;21(14):3097-111
Human molecular genetics 2012 Jul 15;21(14):3097-111
FoxP1 promotes midbrain identity in embryonic stem cell-derived dopamine neurons by regulating Pitx3.
Konstantoulas CJ, Parmar M, Li M
Journal of neurochemistry 2010 May;113(4):836-47
Journal of neurochemistry 2010 May;113(4):836-47
Cooperative regulation in development by SMRT and FOXP1.
Jepsen K, Gleiberman AS, Shi C, Simon DI, Rosenfeld MG
Genes & development 2008 Mar 15;22(6):740-5
Genes & development 2008 Mar 15;22(6):740-5
Integrin engagement regulates monocyte differentiation through the forkhead transcription factor Foxp1.
Shi C, Zhang X, Chen Z, Sulaiman K, Feinberg MW, Ballantyne CM, Jain MK, Simon DI
The Journal of clinical investigation 2004 Aug;114(3):408-18
The Journal of clinical investigation 2004 Aug;114(3):408-18
No comments: Submit comment
No validations: Submit validation data