HPA003876

FOXP1 antibody from Sigma-Aldrich
12CC4, hFKH1B, HSPC215, QRF1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA003876
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA003876, RRID:AB_1078907
Product name
Anti-FOXP1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA003876
Antibody type
Polyclonal
Antigen
Forkhead box protein P1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
QMQQLQQQHLLSLQRQGLLTIQPGQPALPLQPLAQ
GMIPTELQQLWKEVTSAHTAEETTGNNHSSLDLTT
TCVSSSAPSKTSLIMNPHASTNGQLSVHTPKRESL
SHEEHPHSHPLYGHGVCKWPGCEAVCEDFQSFLKH
LNS
Storage
-20C
Provider Type Product Number
- No reagents -