HPA005789

ZBTB17 antibody from Sigma-Aldrich
MIZ1, pHZ-67, ZNF151, ZNF60
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA005789
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA005789, RRID:AB_1080633
Product name
Anti-ZBTB17 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA005789
Antibody type
Polyclonal
Antigen
Zinc finger and BTB domain-containing protein 17 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LSPENVDDVLAVATFLQMQDIITACHALKSLAEPA
TSPGGNAEALATEGGDKRAKEEKVATSTLSRLEQA
GRSTPIGPSRDLKEERGGQAQSAASGAEQTEKADA
PREPPPVELKPDPTSGMAAAEAEAALSESSEQEME
VE
Storage
-20C
Provider Type Product Number
- No reagents -