Antibody data

Product number
ABIN310616
Provider
antibodies-online
Product name
anti-Transmembrane 9 Superfamily Member 1 (TM9SF1) antibody
Provider product page
antibodies-online - ABIN310616
Antibody type
Polyclonal
Antigen
The immunogen for anti-TM9SF1 antibody: synthetic peptide directed towards the middle region of human TM9SF1
Reactivity
Human, Mouse, Rat, Bovine, Canine
Host
Rabbit
Antigen sequence
THTYSVRWSETSVERRSDRRRGDDGGFFPRTLEIH
WLSII NSMVLVFLLV
Vial size
0.1 mg
Provider Type Product Number
- No reagents -