AV44685

TM9SF1 antibody from MilliporeSigma / Merck KGaA
HMP70, MP70
Immunohistochemistry
Recommended by provider

Antibody data

Product number
AV44685
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#AV44685, RRID:AB_1858055
Product name
Anti-TM9SF1 (AB2) antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - AV44685
Antibody type
Polyclonal
Antigen
synthetic peptide corresponding to a region of human TM9SF1 with an internal ID of P12157
Description
IgG fraction of antiserum
Reactivity
Human
Antigen sequence
RSDRRRGDDGGFFPRTLEIHWLSIINSMVLVFLLV
GFVAVILMRVLRNDL
Storage
-20C
Provider Type Product Number
- No reagents -