Explore
Validate
Learn
Western blot
ImmunohistochemistryAntibody data
- Antibody Data
- Antigen structure
- References [3]
- Comments [0]
- Validations
- Western blot [1]
- Immunohistochemistry [5]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA005652 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA005652, RRID:AB_1079418
- Product name
- Anti-MSX2
- Antibody type
- Polyclonal
- Reactivity
- Human, Mouse, Rat
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
SSLPFSVEALMSDKKPPKEASPLPAESASAGATLR
PLLLSGHGAREAHSPGPLVKPFETASVKSENSEDG
AAWMQEPGRYSPPPRHTSPTTCTLRKHKTNRKP- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Differential expression of cartilage and bone-related proteins in pediatric and adult diseased aortic valves.
Extensive expression of craniofacial related homeobox genes in canine mammary sarcomas
Tissue profiling of the mammalian central nervous system using human antibody-based proteomics.
Wirrig EE, Hinton RB, Yutzey KE
Journal of molecular and cellular cardiology 2011 Mar;50(3):561-9
Journal of molecular and cellular cardiology 2011 Mar;50(3):561-9
Extensive expression of craniofacial related homeobox genes in canine mammary sarcomas
Wensman H, Göransson H, Leuchowius K, Strömberg S, Pontén F, Isaksson A, Rutteman G, Heldin N, Pejler G, Hellmén E
Breast Cancer Research and Treatment 2009 November;118(2):333-343
Breast Cancer Research and Treatment 2009 November;118(2):333-343
Tissue profiling of the mammalian central nervous system using human antibody-based proteomics.
Mulder J, Björling E, Jonasson K, Wernérus H, Hober S, Hökfelt T, Uhlén M
Molecular & cellular proteomics : MCP 2009 Jul;8(7):1612-22
Molecular & cellular proteomics : MCP 2009 Jul;8(7):1612-22
No comments: Submit comment
Enhanced validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Genetic validation
- Main image
- Experimental details
- Western blot analysis in Caco-2 cells transfected with control siRNA, target specific siRNA probe #1, using Anti-MSX2 antibody. Remaining relative intensity is presented. Loading control: Anti-PPIB.
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human stomach shows strong cytoplasmic positivity in glandular cells.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human endometrium shows moderate nuclear positivity in glandular cells.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human placenta shows strong nuclear positivity in trophoblastic cells.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human urinary bladder shows weak nuclear positivity in urothelial cells.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human liver shows low positivity in hepatocytes as expected.
- Sample type
- HUMAN
