HPA005652

MSX2 antibody from Sigma-Aldrich
CRS2, FPP, HOX8, MSH, PFM, PFM1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA005652
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA005652, RRID:AB_1079418
Product name
Anti-MSX2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA005652
Antibody type
Polyclonal
Antigen
Homeobox protein MSX-2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SSLPFSVEALMSDKKPPKEASPLPAESASAGATLR
PLLLSGHGAREAHSPGPLVKPFETASVKSENSEDG
AAWMQEPGRYSPPPRHTSPTTCTLRKHKTNRKP
Storage
-20C
Provider Type Product Number
- No reagents -