HPA001755

ELF1 antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA001755
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA001755, RRID:AB_1078732
Product name
Anti-ELF1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA001755
Antibody type
Polyclonal
Antigen
ETS-related transcription factor Elf-1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PSSSIESSDPSLSSSATSNRNQTSRSRVSSSPGVK
GGATTVLKPGNSKAAKPKDPVEVAQPSEVLRTVQP
TQSPYPTQLFRTVHVVQPVQAVPEGEAARTSTMQD
ETLNSSVQSIRTIQAPTQVPVVVSPRNQQL
Storage
-20C
Provider Type Product Number
- No reagents -