HPA001914

NFE2 antibody from Atlas Antibodies
NF-E2
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA001914
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA001914, RRID:AB_1079475
Product name
Anti-NFE2
Provider product page
Atlas Antibodies - HPA001914
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
SRNRVIQLSTSELGEMELTWQEIMSITELQGLNAP
SEPSFEPQAPAPYLGPPPPTTYCPCSIHPDSGFPL
PPPPYELPASTSHVPDPPYSYGNMAIPVSKPLSLS
GLLSEPLQDPLALLDIGLPAGPPKPQEDPES
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -