HPA001914

NFE2 antibody from Sigma-Aldrich
NF-E2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA001914
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA001914, RRID:AB_1079475
Product name
Anti-NFE2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA001914
Antibody type
Polyclonal
Antigen
Transcription factor NF-E2 45 kDa subunit recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SRNRVIQLSTSELGEMELTWQEIMSITELQGLNAP
SEPSFEPQAPAPYLGPPPPTTYCPCSIHPDSGFPL
PPPPYELPASTSHVPDPPYSYGNMAIPVSKPLSLS
GLLSEPLQDPLALLDIGLPAGPPKPQEDPES
Storage
-20C
Provider Type Product Number
- No reagents -