Antibody data

Product number
H00064376-M01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00064376-M01, RRID:AB_1582153
Product name
ZNFN1A5 monoclonal antibody (M01), clone 1B6
Provider product page
Abnova Corporation - H00064376-M01
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant ZNFN1A5.
Antigen sequence
GEKKPEPLDFVKDFQEYLTQQTHHVNMISGSVSGD
KEAEALQGAGTDGDQNGLDHPSVEVSLDENSGMLV
DGFERTFDGKLKCRYCNYASKGTARLIEH
Isotype
IgG
Antibody clone number
1B6
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -