HPA003468

NKX2-2 antibody from Atlas Antibodies
NKX2.2, NKX2B
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA003468
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA003468, RRID:AB_888488
Product name
Anti-NKX2-2
Provider product page
Atlas Antibodies - HPA003468
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
SLTNTKTGFSVKDILDLPDTNDEEGSVAEGPEEEN
EGPEPAKRAGPLGQGALDAVQSLPLKNPFYDSSDN
PYTRWLASTEGLQYSLHGLAAGAPPQDSSSKSPEP
SADESPDNDKETP
Isotype
IgG
Vial size
100 µl
Storage
Store at +4¡C for short term storage. Long time storage is recommended at -20¡C.
Provider Type Product Number
- No reagents -