HPA003468

NKX2-2 antibody from Sigma-Aldrich
NKX2.2, NKX2B
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA003468
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA003468, RRID:AB_1079490
Product name
Anti-NKX2-2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA003468
Antibody type
Polyclonal
Antigen
Homeobox protein Nkx-2.2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SLTNTKTGFSVKDILDLPDTNDEEGSVAEGPEEEN
EGPEPAKRAGPLGQGALDAVQSLPLKNPFYDSSDN
PYTRWLASTEGLQYSLHGLAAGAPPQDSSSKSPEP
SADESPDNDKETP
Storage
-20C
Provider Type Product Number
- No reagents -