Antibody data

Product number
PAB27491
Provider
Abnova Corporation
Product name
MUC12 polyclonal antibody
Provider product page
Abnova Corporation - PAB27491
Antibody type
Polyclonal
Antigen
Recombinant protein corresponding to amino acids of human MUC12.
Reactivity
Human
Host
Rabbit
Antigen sequence
LTEESTTFHTSPSFTSTIVSTESLETLAPGLCQEG
QIWNGKQCVCPQGYVGYQCLSPLESFPVETPEKLN
ATLGMTVKVTYRNFTEKMNDASSQEYQNFSTLFKN
RMDVVLKGDNLPQYRGVNIRRLLNGSIVVKNDVIL
E
Isotype
IgG
Vial size
100 uL
Storage
Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -