HPA023835

MUC12 antibody from Sigma-Aldrich
MUC11
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA023835
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA023835, RRID:AB_1854199
Product name
Anti-AC105446.4-1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA023835
Antibody type
Polyclonal
Antigen
MUC12 protein Fragment recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
EELFENLAEIVKAKIMNETRTTLLDPDSCRKAILC
YSEEDTFVDSSVTPGFDFQEQCTQKAAEGYTQFYY
VDVLDGKLACVNKCTKGTKSQMNCNLGTCQLQRSG
PRCLCPNTNTHWYWG
Storage
-20C
Provider Type Product Number
- No reagents -