HPA027769

MUC12 antibody from Sigma-Aldrich
MUC11
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA027769
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA027769, RRID:AB_10602186
Product name
Anti-MUC12 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA027769
Antibody type
Polyclonal
Antigen
mucin 12, cell surface associated recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LTEESTTFHTSPSFTSTIVSTESLETLAPGLCQEG
QIWNGKQCVCPQGYVGYQCLSPLESFPVETPEKLN
ATLGMTVKVTYRNFTEKMNDASSQEYQNFSTLFKN
RMDVVLKGDNLPQYRGVNIRRLLNGSIVVKNDVIL
E
Storage
-20C
Provider Type Product Number
- No reagents -