HPA018020

GPR149 antibody from Sigma-Aldrich
IEDA, PGR10
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA018020
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA018020, RRID:AB_1849334
Product name
Anti-GPR149 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA018020
Antibody type
Polyclonal
Antigen
Probable G-protein coupled receptor 149 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
CGCIINCRQNAYAVASDGKKIKRKGFEFNLSFQKS
YGIYKIAHEDYYDDDENSIFYHNLMNSECETTKDP
QRDNRNIFNAIKVEISTTPSLDSSTQRGINKCTNT
DITEAKQDSNNKKDAFSDKTGGDINYEETTFSEGP
ERRLSH
Storage
-20C
Provider Type Product Number
- No reagents -