Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA005968 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA005968, RRID:AB_1079066
- Product name
- Anti-HLX
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
CSFPLDPAAVKKPSFCIADILHAGVGDLGAAPEGL
AGASAAALTAHLGSVHPHASFQAAARSPLRPTPVV
APSEVPAGFPQRLSPLPAAYHHHHPQQQQQQQ- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Interplay between Homeobox proteins and Polycomb repressive complexes in p16INK⁴a regulation.
Martin N, Popov N, Aguilo F, O'Loghlen A, Raguz S, Snijders AP, Dharmalingam G, Li S, Thymiakou E, Carroll T, Zeisig BB, So CW, Peters G, Episkopou V, Walsh MJ, Gil J
The EMBO journal 2013 Apr 3;32(7):982-95
The EMBO journal 2013 Apr 3;32(7):982-95
No comments: Submit comment
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescent staining of human cell line HEK 293 shows positivity in nucleus & cytoplasm.
- Sample type
- HUMAN
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human tonsil shows strong nuclear positivity in reaction center cells.
- Sample type
- HUMAN