HPA005968

HLX antibody from Sigma-Aldrich
HB24, HLX1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA005968
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA005968, RRID:AB_1079066
Product name
Anti-HLX antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA005968
Antibody type
Polyclonal
Antigen
H2.0-like homeobox protein recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
CSFPLDPAAVKKPSFCIADILHAGVGDLGAAPEGL
AGASAAALTAHLGSVHPHASFQAAARSPLRPTPVV
APSEVPAGFPQRLSPLPAAYHHHHPQQQQQQQ
Storage
-20C
Provider Type Product Number
- No reagents -