Explore
Validate
LearnHPA029981
antibody from Atlas Antibodies
Targeting: SMARCA2
BAF190, BRM, hBRM, hSNF2a, SNF2, SNF2L2, SNF2LA, Sth1p, SWI2
Immunocytochemistry
ImmunohistochemistryAntibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Immunocytochemistry [1]
- Immunohistochemistry [6]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA029981 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA029981, RRID:AB_10602406
- Product name
- Anti-SMARCA2
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
SPVQLHQLRAQILAYKMLARGQPLPETLQLAVQGK
RTLPGLQQQQQQQQQQQQQQQQQQQQQQQPQQQPP
QPQTQQQQQPALVNYNRPSGPGPELSGPSTPQKLP
VP- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Concomitant loss of SMARCA2 and SMARCA4 expression in small cell carcinoma of the ovary, hypercalcemic type.
Heterozygous missense mutations in SMARCA2 cause Nicolaides-Baraitser syndrome
Jelinic P, Schlappe BA, Conlon N, Tseng J, Olvera N, Dao F, Mueller JJ, Hussein Y, Soslow RA, Levine DA
Modern pathology : an official journal of the United States and Canadian Academy of Pathology, Inc 2016 Jan;29(1):60-6
Modern pathology : an official journal of the United States and Canadian Academy of Pathology, Inc 2016 Jan;29(1):60-6
Heterozygous missense mutations in SMARCA2 cause Nicolaides-Baraitser syndrome
Van Houdt J, Nowakowska B, Sousa S, van Schaik B, Seuntjens E, Avonce N, Sifrim A, Abdul-Rahman O, van den Boogaard M, Bottani A, Castori M, Cormier-Daire V, Deardorff M, Filges I, Fryer A, Fryns J, Gana S, Garavelli L, Gillessen-Kaesbach G, Hall B, Horn D, Huylebroeck D, Klapecki J, Krajewska-Walasek M, Kuechler A, Lines M, Maas S, MacDermot K, McKee S, Magee A, de Man S, Moreau Y, Morice-Picard F, Obersztyn E, Pilch J, Rosser E, Shannon N, Stolte-Dijkstra I, Van Dijck P, Vilain C, Vogels A, Wakeling E, Wieczorek D, Wilson L, Zuffardi O, van Kampen A, Devriendt K, Hennekam R, Vermeesch J
Nature Genetics 2012 February;44(4):445-449
Nature Genetics 2012 February;44(4):445-449
No comments: Submit comment
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm & vesicles.
- Sample type
- HUMAN
Enhanced validation
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Orthogonal validation
- Main image
- Experimental details
- Immunohistochemistry analysis in human testis and pancreas tissues using HPA029981 antibody. Corresponding SMARCA2 RNA-seq data are presented for the same tissues.
- Sample type
- HUMAN
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human cerebral cortex shows strong nuclear positivity in neuronal cells.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human testis shows strong nuclear positivity in cells in seminiferous ducts.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human cerebral cortex shows moderate to strong nuclear positivity in neuronal cells.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human fallopian tube shows strong nuclear positivity in glandular cells.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human pancreas shows weak to moderate nuclear positivity in exocrine glandular cells.
- Sample type
- HUMAN
