H00006595-M06
antibody from Abnova Corporation
Targeting: SMARCA2
BAF190, BRM, hBRM, hSNF2a, SNF2, SNF2L2, SNF2LA, Sth1p, SWI2
Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- ELISA [1]
- Immunocytochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00006595-M06 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00006595-M06, RRID:AB_581779
- Product name
- SMARCA2 monoclonal antibody (M06), clone 2D12
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant SMARCA2.
- Antigen sequence
KILLDPNSEEVSEKDAKQIIETAKQDVDDEYSMQY
SARGSQSYYTVAHAISERVEKQSALLINGTLKHYQ
LQGLEWM- Isotype
- IgG
- Antibody clone number
- 2D12
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged SMARCA2 is approximately 0.1ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of monoclonal antibody to SMARCA2 on HeLa cell . [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol