ABIN183018
antibody from antibodies-online
Targeting: SMARCA2
BAF190, BRM, hBRM, hSNF2a, SNF2, SNF2L2, SNF2LA, Sth1p, SWI2
Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN183018 - Provider product page

- Provider
- antibodies-online
- Product name
- anti-SWI/SNF Related, Matrix Associated, Actin Dependent Regulator of Chromatin, Subfamily A, Member 2 (SMARCA2) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-SMARCA2 antibody: synthetic peptide directed towards the middle region of human SMARCA2
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Xenopus, Zebrafish
- Host
- Rabbit
- Antigen sequence
VINYKDSSGRQLSEVFIQLPSRKELPEYYELIRKP
VDFKK IKERIRNHKY- Epitope
- Middle Region
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Assignment of HBRM, the human homolog of S. cerevisiae SNF2/SWI2 and Drosophila brm genes, to chromosome region 9p23-p24, by in situ hybridization.
Muchardt C, Yaniv M, Mattei MG
Mammalian genome : official journal of the International Mammalian Genome Society 1994 Apr;5(4):241-3
Mammalian genome : official journal of the International Mammalian Genome Society 1994 Apr;5(4):241-3
No comments: Submit comment
No validations: Submit validation data