Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00056940-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00056940-M01, RRID:AB_530028
- Product name
- DUSP22 monoclonal antibody (M01), clone 3D3
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant DUSP22.
- Antigen sequence
EDALHTVRAGRSCANPNVGFQRQLQEFEKHEVHQY
RQWLKEEYGESPLQDAEEAKNILAAPGILKFWAFL
RRL- Isotype
- IgG
- Antibody clone number
- 3D3
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Promoter hypermethylation of the phosphatase DUSP22 mediates PKA-dependent TAU phosphorylation and CREB activation in Alzheimer's disease.
JNK pathway-associated phosphatase dephosphorylates focal adhesion kinase and suppresses cell migration.
Sanchez-Mut JV, Aso E, Heyn H, Matsuda T, Bock C, Ferrer I, Esteller M
Hippocampus 2014 Apr;24(4):363-8
Hippocampus 2014 Apr;24(4):363-8
JNK pathway-associated phosphatase dephosphorylates focal adhesion kinase and suppresses cell migration.
Li JP, Fu YN, Chen YR, Tan TH
The Journal of biological chemistry 2010 Feb 19;285(8):5472-8
The Journal of biological chemistry 2010 Feb 19;285(8):5472-8
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of DUSP22 expression in transfected 293T cell line by DUSP22 monoclonal antibody (M01), clone 3D3.Lane 1: DUSP22 transfected lysate(20.9 KDa).Lane 2: Non-transfected lysate.