H00010660-M02

LBX1 antibody from Abnova Corporation
HPX6, LBX1H
No application information provided.

Antibody data

Product number
H00010660-M02
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00010660-M02, RRID:AB_875664
Product name
LBX1 monoclonal antibody (M02), clone 2A9
Provider product page
Abnova Corporation - H00010660-M02
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full length recombinant LBX1.
Antigen sequence
TNHQIYELEKRFLYQKYLSPADRDQIAQQLGLTNA
QVITWFQNRRAKLKRDLEEMKADVESAKKLGPSGQ
MDIVALAELEQNSEATA
Isotype
IgG
Antibody clone number
2A9
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.