HPA002016

LBX1 antibody from Atlas Antibodies
HPX6, LBX1H

Antibody data

Product number
HPA002016
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA002016, RRID:AB_2666518
Product name
Anti-LBX1
Provider product page
Atlas Antibodies - HPA002016
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
ITWFQNRRAKLKRDLEEMKADVESAKKLGPSGQMD
IVALAELEQNSEATAGGGGGCGRAKSRPGSPVLPP
GAPKAPGAGALQLSPASPLTDQPASSQDCSEDEED
EEIDVD
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.