HPA019493

LCP1 antibody from Atlas Antibodies
CP64, L-PLASTIN, LC64P, PLS2
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA019493
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA019493, RRID:AB_1855457
Product name
Anti-LCP1
Provider product page
Atlas Antibodies - HPA019493
Antibody type
Polyclonal
Reactivity
Human, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
FAKVDTDGNGYISFNELNDLFKAACLPLPGYRVRE
ITENLMATGDLDQDGRISFDEFIKI
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -