Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [2]
- Immunocytochemistry [1]
- Immunohistochemistry [3]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA019493 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA019493, RRID:AB_1855457
- Product name
- Anti-LCP1
- Antibody type
- Polyclonal
- Reactivity
- Human, Rat
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
FAKVDTDGNGYISFNELNDLFKAACLPLPGYRVRE
ITENLMATGDLDQDGRISFDEFIKI- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Affinity Proteomics Reveals Elevated Muscle Proteins in Plasma of Children with Cerebral Malaria
Bachmann J, Burté F, Pramana S, Conte I, Brown B, Orimadegun A, Ajetunmobi W, Afolabi N, Akinkunmi F, Omokhodion S, Akinbami F, Shokunbi W, Kampf C, Pawitan Y, Uhlén M, Sodeinde O, Schwenk J, Wahlgren M, Fernandez-Reyes D, Nilsson P, Kim K
PLoS Pathogens 2014 April;10(4)
PLoS Pathogens 2014 April;10(4)
No comments: Submit comment
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11Lane 2: Human cell line RT-4
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescent staining of human cell line U-2 OS shows localization to plasma membrane, cytosol & actin filaments.
- Sample type
- HUMAN
Enhanced validation
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Orthogonal validation
- Main image
- Experimental details
- Immunohistochemistry analysis in human spleen and skeletal muscle tissues using Anti-LCP1 antibody. Corresponding LCP1 RNA-seq data are presented for the same tissues.
- Sample type
- HUMAN
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human spleen shows high expression.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human skeletal muscle shows low expression as expected.
- Sample type
- HUMAN