HPA019493

LCP1 antibody from Sigma-Aldrich
CP64, L-PLASTIN, LC64P, PLS2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA019493
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA019493, RRID:AB_1855457
Product name
Anti-LCP1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA019493
Antibody type
Polyclonal
Antigen
Plastin-2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
FAKVDTDGNGYISFNELNDLFKAACLPLPGYRVRE
ITENLMATGDLDQDGRISFDEFIKI
Storage
-20C
Provider Type Product Number
- No reagents -