Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN309635 - Provider product page

- Provider
- antibodies-online
- Product name
- anti-Iroquois Homeobox Protein 4 (IRX4) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-IRX4 antibody: synthetic peptide directed towards the N terminal of human IRX4
- Reactivity
- Human, Mouse, Rat, Bovine, Xenopus
- Host
- Rabbit
- Antigen sequence
SAAALGVYGGPYGGSQGYGNYVTYGSEASAFYSLN
SFDSK DGSGSAHGGL- Vial size
- 0.1 mg
Submitted references Catalytic mechanism revealed by the crystal structure of undecaprenyl pyrophosphate synthase in complex with sulfate, magnesium, and triton.
Irx4 forms an inhibitory complex with the vitamin D and retinoic X receptors to regulate cardiac chamber-specific slow MyHC3 expression.
Chang SY, Ko TP, Liang PH, Wang AH
The Journal of biological chemistry 2003 Aug 1;278(31):29298-307
The Journal of biological chemistry 2003 Aug 1;278(31):29298-307
Irx4 forms an inhibitory complex with the vitamin D and retinoic X receptors to regulate cardiac chamber-specific slow MyHC3 expression.
Wang GF, Nikovits W Jr, Bao ZZ, Stockdale FE
The Journal of biological chemistry 2001 Aug 3;276(31):28835-41
The Journal of biological chemistry 2001 Aug 3;276(31):28835-41
No comments: Submit comment
No validations: Submit validation data