Antibody data
- Antibody Data
- Antigen structure
- References [3]
- Comments [0]
- Validations
- Western blot [3]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00051176-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00051176-M01, RRID:AB_425974
- Product name
- LEF1 monoclonal antibody (M01), clone 3H5
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a full length recombinant LEF1.
- Antigen sequence
MPQLSGGGGGGGGDPELCATDEMIPFKDEGDPQKE
KIFAEISHPEEEGDLADIKSSLVNESEIIPASNGH
EVARQAQTSQEPYHDKAREHPDDGKHPDGGLYNKG
PSYSSYSGYIMMPNMNNDPYMSNGSLSPPIPRTSN
KVPVVQPSHAVHPLTPLITYSDEHFSPGSHPSHIP
SDVNSKQGMSRHPPAPDIPTFYPLSPGGVGQITPP
LGWQGQPVYPITGGFRQPYPSSLSVDTSMSRFSHH
MIPGPPGPHTTGIPHPAIVTPQVKQEHPHTDSDLM
HVKPQHEQRKEQEPKRPHIKKPLNAFMLYMKEMRA
NVVAECTLKESAAINQILGRRWHALSREEQAKYYE
LARKERQLHMQLYPGWSARDNYGKKKKRKREKLQE
SASGTGPRMTAAYI- Isotype
- IgG
- Antibody clone number
- 3H5
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Rac1 augments Wnt signaling by stimulating β-catenin-lymphoid enhancer factor-1 complex assembly independent of β-catenin nuclear import.
Regulation of β-catenin nuclear dynamics by GSK-3β involves a LEF-1 positive feedback loop.
LEF-1 negatively controls interleukin-4 expression through a proximal promoter regulatory element.
Jamieson C, Lui C, Brocardo MG, Martino-Echarri E, Henderson BR
Journal of cell science 2015 Nov 1;128(21):3933-46
Journal of cell science 2015 Nov 1;128(21):3933-46
Regulation of β-catenin nuclear dynamics by GSK-3β involves a LEF-1 positive feedback loop.
Jamieson C, Sharma M, Henderson BR
Traffic (Copenhagen, Denmark) 2011 Aug;12(8):983-99
Traffic (Copenhagen, Denmark) 2011 Aug;12(8):983-99
LEF-1 negatively controls interleukin-4 expression through a proximal promoter regulatory element.
Hebenstreit D, Giaisi M, Treiber MK, Zhang XB, Mi HF, Horejs-Hoeck J, Andersen KG, Krammer PH, Duschl A, Li-Weber M
The Journal of biological chemistry 2008 Aug 15;283(33):22490-7
The Journal of biological chemistry 2008 Aug 15;283(33):22490-7
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- LEF1 monoclonal antibody (M01), clone 3H5 Western Blot analysis of LEF1 expression in MES-SA/Dx5 ( Cat # L021V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- LEF1 monoclonal antibody (M01), clone 3H5. Western Blot analysis of LEF1 expression in HL-60 ( Cat # L014V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of LEF1 expression in transfected 293T cell line by LEF1 monoclonal antibody (M01), clone 3H5.Lane 1: LEF1 transfected lysate(44.2 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged LEF1 is approximately 0.3ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol