Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN406778 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Lymphoid Enhancer-Binding Factor 1 (LEF1) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-LEF1 antibody: synthetic peptide directed towards the N terminal of human LEF1
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Porcine, Rabbit
- Host
- Rabbit
- Antigen sequence
VARQAQTSQEPYHDKAREHPDDGKHPDGGLYNKGP
SYSSY SGYIMMPNMN- Vial size
- 50 μg
- Storage
- Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen. For longer periods of storage, store at -20°C
Submitted references A novel role for Lef-1, a central transcription mediator of Wnt signaling, in leukemogenesis.
Petropoulos K, Arseni N, Schessl C, Stadler CR, Rawat VP, Deshpande AJ, Heilmeier B, Hiddemann W, Quintanilla-Martinez L, Bohlander SK, Feuring-Buske M, Buske C
The Journal of experimental medicine 2008 Mar 17;205(3):515-22
The Journal of experimental medicine 2008 Mar 17;205(3):515-22
No comments: Submit comment
No validations: Submit validation data