HPA002087

LEF1 antibody from Sigma-Aldrich
TCF10, TCF1ALPHA, TCF7L3
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA002087
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA002087, RRID:AB_1079245
Product name
Anti-LEF1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA002087
Antibody type
Polyclonal
Antigen
Lymphoid enhancer-binding factor 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SDVNSKQGMSRHPPAPDIPTFYPLSPGGVGQITPP
LGWQGQPVYPITGGFRQPYPSSLSVDTSMSRFSHH
MIPGPPGPHTTGIPHPAIVTPQVKQEHPHTDSDLM
HVKPQHEQRKEQEPKRPHIKKPLNAFMLY
Storage
-20C
Provider Type Product Number
- No reagents -