Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [2]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00006938-M01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00006938-M01, RRID:AB_509149
- Product name
- TCF12 monoclonal antibody (M01), clone 2E9
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant TCF12.
- Antigen sequence
VGSPSPLTGTSQWPRPGGQAPSSPSYENSLHSLKN
RVEQQLHEHLQDAMSFLKDVCEQSRMEDRLDRLDD
AIHVLRNHAVGPSTSLPAGH- Isotype
- IgG
- Antibody clone number
- 2E9
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- TCF12 monoclonal antibody (M01), clone 2E9 Western Blot analysis of TCF12 expression in Jurkat ( Cat # L017V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of TCF12 expression in transfected 293T cell line by TCF12 monoclonal antibody (M01), clone 2E9.Lane 1: TCF12 transfected lysate(75.8 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunoperoxidase of monoclonal antibody to TCF12 on formalin-fixed paraffin-embedded human tonsil. [antibody concentration 1 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol