Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN184293 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Transcription Factor 12 (TCF12) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-TCF12 antibody: synthetic peptide directed towards the N terminal of human TCF12
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Chicken/Avian, Xenopus, Zebrafish
- Host
- Rabbit
- Antigen sequence
QQQRMAAIGTDKELSDLLDFSAMFSPPVNSGKTRP
TTLGS SQFSGSGIDE- Vial size
- 50 μg
- Storage
- Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen. For longer periods of storage, store at -20°C
Submitted references The high-mobility-group domain of Sox proteins interacts with DNA-binding domains of many transcription factors.
E protein silencing by the leukemogenic AML1-ETO fusion protein.
Wissmüller S, Kosian T, Wolf M, Finzsch M, Wegner M
Nucleic acids research 2006;34(6):1735-44
Nucleic acids research 2006;34(6):1735-44
E protein silencing by the leukemogenic AML1-ETO fusion protein.
Zhang J, Kalkum M, Yamamura S, Chait BT, Roeder RG
Science (New York, N.Y.) 2004 Aug 27;305(5688):1286-9
Science (New York, N.Y.) 2004 Aug 27;305(5688):1286-9
No comments: Submit comment
No validations: Submit validation data