Antibody data
- Antibody Data
- Antigen structure
- References [3]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00079192-A01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00079192-A01, RRID:AB_462925
- Product name
- IRX1 polyclonal antibody (A01)
- Antibody type
- Polyclonal
- Description
- Mouse polyclonal antibody raised against a partial recombinant IRX1.
- Antigen sequence
NGDKASVRSSPTLPERDLVPRPDSPAQQLKSPFQP
VRDNSLAPQEGTPRILAALPS- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Identification and characterization of a novel ubiquitous nucleolar protein 'NARR' encoded by a gene overlapping the rab34 oncogene.
Helicobacter pylori induces promoter hypermethylation and downregulates gene expression of IRX1 transcription factor on human gastric mucosa.
Homeobox gene IRX1 is a tumor suppressor gene in gastric carcinoma.
Zougman A, Mann M, Wisniewski JR
Nucleic acids research 2011 Sep 1;39(16):7103-13
Nucleic acids research 2011 Sep 1;39(16):7103-13
Helicobacter pylori induces promoter hypermethylation and downregulates gene expression of IRX1 transcription factor on human gastric mucosa.
Guo XB, Guo L, Zhi QM, Ji J, Jiang JL, Zhang RJ, Zhang JN, Zhang J, Chen XH, Cai Q, Li JF, Yan M, Gu QL, Liu BY, Zhu ZG, Yu YY
Journal of gastroenterology and hepatology 2011 Nov;26(11):1685-90
Journal of gastroenterology and hepatology 2011 Nov;26(11):1685-90
Homeobox gene IRX1 is a tumor suppressor gene in gastric carcinoma.
Guo X, Liu W, Pan Y, Ni P, Ji J, Guo L, Zhang J, Wu J, Jiang J, Chen X, Cai Q, Li J, Zhang J, Gu Q, Liu B, Zhu Z, Yu Y
Oncogene 2010 Jul 8;29(27):3908-20
Oncogene 2010 Jul 8;29(27):3908-20
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- IRX1 polyclonal antibody (A01), Lot # 051025JC01 Western Blot analysis of IRX1 expression in Y-79 ( Cat # L042V1 ).