HPA027059

COL26A1 antibody from Atlas Antibodies
EMI6, EMID2, Emu2
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA027059
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA027059, RRID:AB_1848142
Product name
Anti-COL26A1
Provider product page
Atlas Antibodies - HPA027059
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
ANLVSYRTLIRPTYRVSYRTVTVLEWRCCPGFTGS
NCDEECMNCTRLSDMSERLTTLEAKVLLLEAAERP
SSPDNDLPAPESTPPTWNEDFLPDAIPLAHPVP
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -