HPA001757

MZF1 antibody from Atlas Antibodies
MZF-1, MZF1B, Zfp98, ZNF42, ZSCAN6
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA001757
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA001757, RRID:AB_611894
Product name
Anti-MZF1
Provider product page
Atlas Antibodies - HPA001757
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
TLTQHLRVHTGEKPFACPECGQRFSQRLKLTRHQR
THTGEKPYHCGECGLGFTQVSRLTEHQRIHTGERP
FACPECGQSFRQHANLTQHRRIHTGERPYACPECG
KAFRQRPTLTQHLRTHRREKPFACQDCGRRFHQST
K
Isotype
IgG
Vial size
100 µl
Storage
Store at +4¡C for short term storage. Long time storage is recommended at -20¡C.
Provider Type Product Number
- No reagents -