Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN487151 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Zinc Finger Protein 42 (ZFP42) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-MZF1 antibody: synthetic peptide directed towards the N terminal of human MZF1
- Description
- Affinity Purified
- Reactivity
- Human
- Host
- Rabbit
- Antigen sequence
RPAVLGSPDRAPPEDEGPVMVKLEDSEEEGEAALW
DPGPE AARLRFRCFR- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Crucial roles of MZF1 and Sp1 in the transcriptional regulation of the peptidylarginine deiminase type I gene (PADI1) in human keratinocytes.
Dong S, Ying S, Kojima T, Shiraiwa M, Kawada A, Méchin MC, Adoue V, Chavanas S, Serre G, Simon M, Takahara H
The Journal of investigative dermatology 2008 Mar;128(3):549-57
The Journal of investigative dermatology 2008 Mar;128(3):549-57
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Host: Rabbit Target Name: MZF1 Sample Tissue: Human Fetal Muscle Antibody Dilution: 1.0 μg/mL