HPA001757

MZF1 antibody from Sigma-Aldrich
MZF-1, MZF1B, Zfp98, ZNF42, ZSCAN6
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA001757
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA001757, RRID:AB_1080718
Product name
Anti-MZF1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA001757
Antibody type
Polyclonal
Antigen
Myeloid zinc finger 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
TLTQHLRVHTGEKPFACPECGQRFSQRLKLTRHQR
THTGEKPYHCGECGLGFTQVSRLTEHQRIHTGERP
FACPECGQSFRQHANLTQHRRIHTGERPYACPECG
KAFRQRPTLTQHLRTHRREKPFACQDCGRRFHQST
K
Storage
-20C
Provider Type Product Number
- No reagents -