H00023365-A01

ARHGEF12 antibody from Abnova Corporation
KIAA0382, LARG
No application information provided.

Antibody data

Product number
H00023365-A01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00023365-A01, RRID:AB_1139183
Product name
ARHGEF12 polyclonal antibody (A01)
Provider product page
Abnova Corporation - H00023365-A01
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a partial recombinant ARHGEF12.
Antigen sequence
VSREGILSPSELRKIFSNLEDILQLHIGLNEQMKA
VRKRNETSVIDQIGEDLLTWFSGPGEEKLKHAAAT
FCSNQPFALEMIKSRQKKDSRFQTFVQDAE
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -