HPA018911

ARHGEF12 antibody from Sigma-Aldrich
KIAA0382, LARG
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA018911
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA018911, RRID:AB_1845003
Product name
Anti-ARHGEF12 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA018911
Antibody type
Polyclonal
Antigen
Rho guanine nucleotide exchange factor 12 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
MAASVKEQSTKPIPLPQSTPGEGDNDEEDPSKLKE
EQHGISVTGLQSPDRDLGLESTLISSKPQSHSLST
SGKSEVRDLFVAERQFAKEQHTDGTLKEVGEDYQ
Storage
-20C
Provider Type Product Number
- No reagents -