Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN309851 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-SRY (Sex Determining Region Y)-Box 9 (SOX9) (C-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-SOX9 antibody: synthetic peptide directed towards the C terminal of human SOX9
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Canine, Chicken/Avian, Porcine
- Host
- Rabbit
- Antigen sequence
AGQGTGLYSTFTYMNPAQRPMYTPIADTSGVPSIP
QTHSP QHWEQPVYTQ- Epitope
- C-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Conserved sex-specific timing of meiotic initiation during sex differentiation in the protandrous black porgy Acanthopagrus schlegelii.
SOX9 expression is a general marker of basal cell carcinoma and adnexal-related neoplasms.
Lau EL, Lee MF, Chang CF
Biology of reproduction 2013 Jun;88(6):150
Biology of reproduction 2013 Jun;88(6):150
SOX9 expression is a general marker of basal cell carcinoma and adnexal-related neoplasms.
Vidal VP, Ortonne N, Schedl A
Journal of cutaneous pathology 2008 Apr;35(4):373-9
Journal of cutaneous pathology 2008 Apr;35(4):373-9
No comments: Submit comment
No validations: Submit validation data